PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00876.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 813aa    MW: 92469.6 Da    PI: 7.1615
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00876.1_g00010.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093363731954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              Fe   ++yp+ +e+  LAk++gL+++qV +WF N R +
  Rsa1.0_00876.1_g00010.1 336 FEHflHPYPKDSEKMMLAKQTGLSKNQVANWFINARVR 373
                              554459******************************87 PP

2BELL109.61.8e-35195264372
                     BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              +elq+kk+kLl +++eVdkrY+qy++q+++++ssFe+vag g++kpYts+Al++iSr+Fr+L+dai eqi
  Rsa1.0_00876.1_g00010.1 195 TELQNKKNKLLAMVDEVDKRYNQYYHQMEALASSFEIVAGFGASKPYTSVALNKISRSFRSLRDAIEEQI 264
                              69*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.4E-38141262IPR006563POX domain
PfamPF075262.6E-38147260IPR006563POX domain
PROSITE profilePS5007112.422314377IPR001356Homeobox domain
SMARTSM003891.2E-8317381IPR001356Homeobox domain
CDDcd000862.74E-10317378No hitNo description
SuperFamilySSF466893.08E-16318382IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-26320381IPR009057Homeodomain-like
PfamPF059202.7E-17334373IPR008422Homeobox KN domain
CDDcd052666.96E-77518789No hitNo description
PfamPF013705.6E-6522732IPR001509NAD-dependent epimerase/dehydratase, N-terminal domain
Gene3DG3DSA:3.40.50.7203.0E-21522802IPR016040NAD(P)-binding domain
SuperFamilySSF517356.02E-29522808IPR016040NAD(P)-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
GO:0050662Molecular Functioncoenzyme binding
Sequence ? help Back to Top
Protein Sequence    Length: 813 aa     Download sequence    Send to blast
MAVYYSSNVN YYQQEPIFLN HQQQQQEASS SSAEHVRNEM VFIPPTTGTT GVVTGLQNLN  60
GTVSSSDPSF HDGQGLSLTL GNQISLPSFH HQQYHHQLAF TPPFNVEEEK SKEMMSSLLL  120
LCQSNPSSGY AAGLYNNYRY NETSGGLRFS RYLKPAQSLL GEVVSVKKEM RNKKKKGQDF  180
NDGSKDTESG ELSTTELQNK KNKLLAMVDE VDKRYNQYYH QMEALASSFE IVAGFGASKP  240
YTSVALNKIS RSFRSLRDAI EEQIQIVREK LGEKGGGDLS LDEQQGGERI PRLRYLDQRL  300
RQQRAFHQQI GMVRPSWRPQ RGLPENSVSA LRAWLFEHFL HPYPKDSEKM MLAKQTGLSK  360
NQVANWFINA RVRVWKPMIE DIYKQEFGED ESELRISKSS QEPNITNQED SSSSQQQPED  420
NNNTAYPSAD ATKTVFSSDE PKQQEMNRSG DYETLLNNYQ GLPPMSMEVF QLSPEIPFRF  480
NHIPTKFSNR SRINSCRPLS ATSDSRSTTP DSESRNRMFI LGTGFVGGFF AEKLKEADWL  540
VSGSCRSDSK KKEWEKKGID LHLFSADSPQ WRLLETVKDY THLLVSIPPL ADVGDPMLRN  600
VELVREKLSS GNLQWLCYLS STSVYGDYDG AWVTEDDPPN PKTQSAKIRL AAEEGWLSLG  660
SDLGVSTQVL RLGGIYGPGR SAIDTLLKRE HLSETQLRRA SRRFTSRVHV QDICQALQAS  720
IENPSSREIY NIVDDDPAPR EEVFQYALEL IEKRWKRKIE TKPFMYESRE QSSLRGEKRV  780
SNEHMKDKLG VKLLHPSYKS GLQSIVEKMD NPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ius_A7e-395188058280uncharacterized conserved protein
3ius_B7e-395188058280uncharacterized conserved protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587448.10.0PREDICTED: BEL1-like homeodomain protein 10
RefseqXP_013587449.10.0PREDICTED: BEL1-like homeodomain protein 10
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLA0A0D3CBK80.0A0A0D3CBK8_BRAOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.31e-178BEL1-like homeodomain 10